Lineage for d1c9tl_ (1c9t L:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636752Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 2636753Family g.3.15.1: Huristasin-like [57263] (3 proteins)
  6. 2636754Protein Bdellastasin [57266] (1 species)
  7. 2636755Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57267] (3 PDB entries)
  8. 2636763Domain d1c9tl_: 1c9t L: [44365]
    Other proteins in same PDB: d1c9ta_, d1c9tb_, d1c9tc_, d1c9td_, d1c9te_, d1c9tf_

Details for d1c9tl_

PDB Entry: 1c9t (more details), 3.3 Å

PDB Description: complex of bdellastasin with bovine trypsin
PDB Compounds: (L:) bdellastasin

SCOPe Domain Sequences for d1c9tl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9tl_ g.3.15.1 (L:) Bdellastasin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq

SCOPe Domain Coordinates for d1c9tl_:

Click to download the PDB-style file with coordinates for d1c9tl_.
(The format of our PDB-style files is described here.)

Timeline for d1c9tl_: