![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) ![]() |
![]() | Family g.3.15.1: Huristasin-like [57263] (3 proteins) |
![]() | Protein Bdellastasin [57266] (1 species) |
![]() | Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57267] (3 PDB entries) |
![]() | Domain d1c9th_: 1c9t H: [44361] Other proteins in same PDB: d1c9ta_, d1c9tb_, d1c9tc_, d1c9td_, d1c9te_, d1c9tf_ |
PDB Entry: 1c9t (more details), 3.3 Å
SCOPe Domain Sequences for d1c9th_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9th_ g.3.15.1 (H:) Bdellastasin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
Timeline for d1c9th_: