Lineage for d1c2aa2 (1c2a A:65-123)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40153Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 40154Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 40155Protein Bowman-Birk inhibitor, BBI [57249] (6 species)
  7. 40158Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (1 PDB entry)
  8. 40160Domain d1c2aa2: 1c2a A:65-123 [44350]

Details for d1c2aa2

PDB Entry: 1c2a (more details), 1.9 Å

PDB Description: crystal structure of barley bbi

SCOP Domain Sequences for d1c2aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2aa2 g.3.13.1 (A:65-123) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare)}
pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct

SCOP Domain Coordinates for d1c2aa2:

Click to download the PDB-style file with coordinates for d1c2aa2.
(The format of our PDB-style files is described here.)

Timeline for d1c2aa2:

40160
d1c2aa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1c2aa1