SCOPe 2.03: Domain d1d6ri_: 1d6r I:

Lineage for d1d6ri_ (1d6r I:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Soybean (Glycine max) [TaxId:3847] [57251] (4 PDB entries)

8. Domain d1d6ri_: 1d6r I: [44343]
   Other proteins in same PDB: d1d6ra_

Details for d1d6ri_

PDB Entry: 1d6r, 2.3 Å

PDB Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity

PDB Compounds: (I:) bowman-birk proteinase inhibitor precursor

SCOPe Domain Sequences for d1d6ri_:

Sequence; same for both SEQRES and ATOM records:

>d1d6ri_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck

Timeline for d1d6ri_:

• d1d6ri_ first appeared (with stable ids) in SCOP 1.55
  
• d1d6ri_ appears in SCOPe 2.02
  
• d1d6ri_ appears in SCOPe 2.04
  
• d1d6ri_ appears in the current release, SCOPe 2.08