| Class g: Small proteins [56992] (94 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
| Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
| Species Malaria parasite (Plasmodium cynomolgi) [TaxId:5827] [57241] (1 PDB entry) |
| Domain d1b9wa2: 1b9w A:46-89 [44335] Other proteins in same PDB: d1b9wa3 |
PDB Entry: 1b9w (more details), 1.8 Å
SCOPe Domain Sequences for d1b9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9wa2 g.3.11.4 (A:46-89) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium cynomolgi) [TaxId: 5827]}
nmtckdknggcapeaeckmndkneivckctkegseplfegvfcs
Timeline for d1b9wa2: