Lineage for d1b9wa2 (1b9w A:46-89)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258722Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 2258723Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)
  7. 2258724Species Malaria parasite (Plasmodium cynomolgi) [TaxId:5827] [57241] (1 PDB entry)
  8. 2258726Domain d1b9wa2: 1b9w A:46-89 [44335]
    Other proteins in same PDB: d1b9wa3

Details for d1b9wa2

PDB Entry: 1b9w (more details), 1.8 Å

PDB Description: c-terminal merozoite surface protein 1 from plasmodium cynomolgi
PDB Compounds: (A:) protein (merozoite surface protein 1)

SCOPe Domain Sequences for d1b9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9wa2 g.3.11.4 (A:46-89) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium cynomolgi) [TaxId: 5827]}
nmtckdknggcapeaeckmndkneivckctkegseplfegvfcs

SCOPe Domain Coordinates for d1b9wa2:

Click to download the PDB-style file with coordinates for d1b9wa2.
(The format of our PDB-style files is described here.)

Timeline for d1b9wa2: