![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
![]() | Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
![]() | Species Malaria parasite (Plasmodium cynomolgi) [TaxId:5827] [57241] (1 PDB entry) |
![]() | Domain d1b9wa1: 1b9w A:1-45 [44334] Other proteins in same PDB: d1b9wa3 |
PDB Entry: 1b9w (more details), 1.8 Å
SCOPe Domain Sequences for d1b9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9wa1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium cynomolgi) [TaxId: 5827]} mssehrcidtnvpenaacyryldgteewrcllyfkedagkcvpap
Timeline for d1b9wa1: