Lineage for d1tpga1 (1tpg A:51-91)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889895Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species)
  7. 889896Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry)
  8. 889897Domain d1tpga1: 1tpg A:51-91 [44325]
    Other proteins in same PDB: d1tpga2
    mutant

Details for d1tpga1

PDB Entry: 1tpg (more details)

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
PDB Compounds: (A:) t-plasminogen activator f1-g

SCOP Domain Sequences for d1tpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}
cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat

SCOP Domain Coordinates for d1tpga1:

Click to download the PDB-style file with coordinates for d1tpga1.
(The format of our PDB-style files is described here.)

Timeline for d1tpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tpga2