SCOP 1.73: Domain d1tpga1: 1tpg A:51-91

Lineage for d1tpga1 (1tpg A:51-91)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry)

8. Domain d1tpga1: 1tpg A:51-91 [44325]
   Other proteins in same PDB: d1tpga2
   mutant

Details for d1tpga1

PDB Entry: 1tpg

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

PDB Compounds: (A:) t-plasminogen activator f1-g

SCOP Domain Sequences for d1tpga1:

Sequence; same for both SEQRES and ATOM records:

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}
cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat

Timeline for d1tpga1:

• d1tpga1 first appeared (with stable ids) in SCOP 1.55, called d1tpg_1
  
• d1tpga1 was called d1tpg_1 in SCOP 1.71
  
• d1tpga1 appears in SCOP 1.75
  
• d1tpga1 appears in the current release, SCOPe 2.08