SCOP 1.57: Domain d1tpg_1: 1tpg 51-91

Lineage for d1tpg_1 (1tpg 51-91)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (5 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry)

8. Domain d1tpg_1: 1tpg 51-91 [44325]
   Other proteins in same PDB: d1tpg_2

Details for d1tpg_1

PDB Entry: 1tpg

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

SCOP Domain Sequences for d1tpg_1:

Sequence; same for both SEQRES and ATOM records:

>d1tpg_1 g.3.11.1 (51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens)}
cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat

Timeline for d1tpg_1:

• d1tpg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1tpg_1 appears in SCOP 1.59
  
• d1tpg_1 appears in the current release, SCOPe 2.08, called d1tpga1