Lineage for d1emn_1 (1emn 2124-2166)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40032Protein Fibrillin-1 fragment (residues 2124-2205) [57227] (1 species)
  7. 40033Species Human (Homo sapiens) [TaxId:9606] [57228] (2 PDB entries)
  8. 40036Domain d1emn_1: 1emn 2124-2166 [44322]

Details for d1emn_1

PDB Entry: 1emn (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, minimized average structure

SCOP Domain Sequences for d1emn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emn_1 g.3.11.1 (2124-2166) Fibrillin-1 fragment (residues 2124-2205) {Human (Homo sapiens)}
savdmdeckepdvckhgqcintdgsyrcecpfgyilagnecvd

SCOP Domain Coordinates for d1emn_1:

Click to download the PDB-style file with coordinates for d1emn_1.
(The format of our PDB-style files is described here.)

Timeline for d1emn_1:

40036
d1emn_1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1emn_2