Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Fibrillin-1 [57227] (1 species) duplication: contains 47 EFG-like domains |
Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries) |
Domain d1emna1: 1emn A:2124-2166 [44322] 39th and 40th calcium-binding EGF-like domains complexed with ca |
PDB Entry: 1emn (more details)
SCOPe Domain Sequences for d1emna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emna1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} savdmdeckepdvckhgqcintdgsyrcecpfgyilagnecvd
Timeline for d1emna1: