![]() | Class g: Small proteins [56992] (72 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (21 proteins) |
![]() | Protein Fibrillin-1 [57227] (1 species) duplication: contains 47 EFG-like domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57228] (6 PDB entries) |
![]() | Domain d1emo_2: 1emo 2167-2205 [44321] 39th and 40th calcium-binding EGF-like domains complexed with ca |
PDB Entry: 1emo (more details)
SCOP Domain Sequences for d1emo_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emo_2 g.3.11.1 (2167-2205) Fibrillin-1 {Human (Homo sapiens)} tdecsvgnpcgngtcknviggfectceegfepgpmmtce
Timeline for d1emo_2: