Lineage for d1emo_2 (1emo 2167-2205)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342211Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 342212Species Human (Homo sapiens) [TaxId:9606] [57228] (3 PDB entries)
  8. 342214Domain d1emo_2: 1emo 2167-2205 [44321]
    39th and 40th calcium-binding EGF-like domains
    complexed with ca

Details for d1emo_2

PDB Entry: 1emo (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, 22 structures

SCOP Domain Sequences for d1emo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emo_2 g.3.11.1 (2167-2205) Fibrillin-1 {Human (Homo sapiens)}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce

SCOP Domain Coordinates for d1emo_2:

Click to download the PDB-style file with coordinates for d1emo_2.
(The format of our PDB-style files is described here.)

Timeline for d1emo_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emo_1