Lineage for d1emo_2 (1emo 2167-2205)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269417Protein Fibrillin-1 fragment (residues 2124-2205) [57227] (1 species)
    duplication: consists of 2 Calcium-binding EGF-like domains
  7. 269418Species Human (Homo sapiens) [TaxId:9606] [57228] (2 PDB entries)
  8. 269420Domain d1emo_2: 1emo 2167-2205 [44321]
    complexed with ca

Details for d1emo_2

PDB Entry: 1emo (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, 22 structures

SCOP Domain Sequences for d1emo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emo_2 g.3.11.1 (2167-2205) Fibrillin-1 fragment (residues 2124-2205) {Human (Homo sapiens)}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce

SCOP Domain Coordinates for d1emo_2:

Click to download the PDB-style file with coordinates for d1emo_2.
(The format of our PDB-style files is described here.)

Timeline for d1emo_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emo_1