Lineage for d1emo_2 (1emo 2167-2205)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (6 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Fibrillin-1 fragment (residues 2124-2205) [57227] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57228] (2 PDB entries) 
Domain d1emo_2: 1emo 2167-2205 [44321]
Details for d1emo_2
PDB Entry: 1emo (more details)
PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, 22 structures
SCOP Domain Sequences for d1emo_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emo_2 g.3.11.1 (2167-2205) Fibrillin-1 fragment (residues 2124-2205) {Human (Homo sapiens)}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce
SCOP Domain Coordinates for d1emo_2:
Click to download the PDB-style file with coordinates for d1emo_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1emo_2:
- d1emo_2 first appeared (with stable ids) in SCOP 1.55
- d1emo_2 appears in SCOP 1.57
- d1emo_2 appears in SCOP 1.61
- d1emo_2 appears in the current release, SCOPe 2.08, called d1emoa2
View in 3D
