Lineage for d1emoa2 (1emo A:2167-2205)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031474Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 3031475Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 3031489Domain d1emoa2: 1emo A:2167-2205 [44321]
    39th and 40th calcium-binding EGF-like domains
    complexed with ca

Details for d1emoa2

PDB Entry: 1emo (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, 22 structures
PDB Compounds: (A:) fibrillin

SCOPe Domain Sequences for d1emoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce

SCOPe Domain Coordinates for d1emoa2:

Click to download the PDB-style file with coordinates for d1emoa2.
(The format of our PDB-style files is described here.)

Timeline for d1emoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emoa1