Lineage for d1dx5l1 (1dx5 L:345-387)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40096Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 40097Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 40107Domain d1dx5l1: 1dx5 L:345-387 [44311]
    Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4

Details for d1dx5l1

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex

SCOP Domain Sequences for d1dx5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx5l1 g.3.11.1 (L:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens)}
vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcq

SCOP Domain Coordinates for d1dx5l1:

Click to download the PDB-style file with coordinates for d1dx5l1.
(The format of our PDB-style files is described here.)

Timeline for d1dx5l1: