Lineage for d1dx5k2 (1dx5 K:388-422)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460296Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 1460297Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 1460305Domain d1dx5k2: 1dx5 K:388-422 [44309]
    Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4
    complexed with ca, fmt, na, ndg

Details for d1dx5k2

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex
PDB Compounds: (K:) thrombomodulin

SCOPe Domain Sequences for d1dx5k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx5k2 g.3.11.1 (K:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
mfcnqtacpadcdpntqascecpegyilddgfict

SCOPe Domain Coordinates for d1dx5k2:

Click to download the PDB-style file with coordinates for d1dx5k2.
(The format of our PDB-style files is described here.)

Timeline for d1dx5k2: