Lineage for d1hrfa_ (1hrf A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031497Protein Heregulin-alpha, EGF-like domain [57223] (1 species)
  7. 3031498Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)
  8. 3031501Domain d1hrfa_: 1hrf A: [44301]

Details for d1hrfa_

PDB Entry: 1hrf (more details)

PDB Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
PDB Compounds: (A:) heregulin alpha

SCOPe Domain Sequences for d1hrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrfa_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk

SCOPe Domain Coordinates for d1hrfa_:

Click to download the PDB-style file with coordinates for d1hrfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hrfa_: