![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Heregulin-alpha, EGF-like domain [57223] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries) |
![]() | Domain d1hrea_: 1hre A: [44300] |
PDB Entry: 1hre (more details)
SCOPe Domain Sequences for d1hrea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek aeelyqk
Timeline for d1hrea_: