Lineage for d1hrea_ (1hre A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889856Protein Heregulin-alpha, EGF-like domain [57223] (1 species)
  7. 889857Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)
  8. 889861Domain d1hrea_: 1hre A: [44300]

Details for d1hrea_

PDB Entry: 1hre (more details)

PDB Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
PDB Compounds: (A:) heregulin alpha

SCOP Domain Sequences for d1hrea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk

SCOP Domain Coordinates for d1hrea_:

Click to download the PDB-style file with coordinates for d1hrea_.
(The format of our PDB-style files is described here.)

Timeline for d1hrea_: