Lineage for d1hafa_ (1haf A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961497Protein Heregulin-alpha, EGF-like domain [57223] (1 species)
  7. 1961498Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)
  8. 1961500Domain d1hafa_: 1haf A: [44299]

Details for d1hafa_

PDB Entry: 1haf (more details)

PDB Description: heregulin-alpha epidermal growth factor-like domain, nmr, minimized average structure
PDB Compounds: (A:) heregulin-alpha

SCOPe Domain Sequences for d1hafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hafa_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}
shlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqekae
ely

SCOPe Domain Coordinates for d1hafa_:

Click to download the PDB-style file with coordinates for d1hafa_.
(The format of our PDB-style files is described here.)

Timeline for d1hafa_: