SCOPe 2.04: Domain d1hafa_: 1haf A:

Lineage for d1hafa_ (1haf A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Heregulin-alpha, EGF-like domain [57223] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)

8. Domain d1hafa_: 1haf A: [44299]

Details for d1hafa_

PDB Entry: 1haf

PDB Description: heregulin-alpha epidermal growth factor-like domain, nmr, minimized average structure

PDB Compounds: (A:) heregulin-alpha

SCOPe Domain Sequences for d1hafa_:

Sequence; same for both SEQRES and ATOM records:

>d1hafa_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}
shlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqekae
ely

Timeline for d1hafa_:

• d1hafa_ first appeared (with stable ids) in SCOP 1.55, called d1haf__
  
• d1hafa_ appears in SCOPe 2.03
  
• d1hafa_ appears in SCOPe 2.05
  
• d1hafa_ appears in the current release, SCOPe 2.08