SCOP 1.55: Domain d1urk_1: 1urk 6-49

Lineage for d1urk_1 (1urk 6-49)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Plasminogen activator (urokinase-type) [57221] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57222] (1 PDB entry)

8. Domain d1urk_1: 1urk 6-49 [44297]
   Other proteins in same PDB: d1urk_2

Details for d1urk_1

PDB Entry: 1urk

PDB Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator

SCOP Domain Sequences for d1urk_1:

Sequence; same for both SEQRES and ATOM records:

>d1urk_1 g.3.11.1 (6-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens)}
qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

Timeline for d1urk_1:

• d1urk_1 appears in SCOP 1.57
  
• d1urk_1 appears in the current release, SCOPe 2.08, called d1urka1