Lineage for d1xdtr_ (1xdt R:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636244Protein Heparin-binding epidermal growth factor, HBEGF [57219] (1 species)
    extracellular domain
  7. 2636245Species Human (Homo sapiens) [TaxId:9606] [57220] (1 PDB entry)
  8. 2636246Domain d1xdtr_: 1xdt R: [44296]
    Other proteins in same PDB: d1xdtt1, d1xdtt2, d1xdtt3

Details for d1xdtr_

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor
PDB Compounds: (R:) heparin-binding epidermal growth factor

SCOPe Domain Sequences for d1xdtr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}
pclrkykdfcihgeckyvkelrapscichpgyhgerchgls

SCOPe Domain Coordinates for d1xdtr_:

Click to download the PDB-style file with coordinates for d1xdtr_.
(The format of our PDB-style files is described here.)

Timeline for d1xdtr_: