Lineage for d1xdtr_ (1xdt R:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269423Protein Heparin-binding epidermal growth factor, HBEGF [57219] (1 species)
    extracellular domain
  7. 269424Species Human (Homo sapiens) [TaxId:9606] [57220] (1 PDB entry)
  8. 269425Domain d1xdtr_: 1xdt R: [44296]
    Other proteins in same PDB: d1xdtt1, d1xdtt2, d1xdtt3

Details for d1xdtr_

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor

SCOP Domain Sequences for d1xdtr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens)}
pclrkykdfcihgeckyvkelrapscichpgyhgerchgls

SCOP Domain Coordinates for d1xdtr_:

Click to download the PDB-style file with coordinates for d1xdtr_.
(The format of our PDB-style files is described here.)

Timeline for d1xdtr_: