Lineage for d3tgf__ (3tgf -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143282Protein Transforming growth factor alpha [57217] (1 species)
  7. 143283Species Human (Homo sapiens) [TaxId:9606] [57218] (5 PDB entries)
  8. 143284Domain d3tgf__: 3tgf - [44292]

Details for d3tgf__

PDB Entry: 3tgf (more details)

PDB Description: the solution structure of human transforming growth factor alpha

SCOP Domain Sequences for d3tgf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgf__ g.3.11.1 (-) Transforming growth factor alpha {Human (Homo sapiens)}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d3tgf__:

Click to download the PDB-style file with coordinates for d3tgf__.
(The format of our PDB-style files is described here.)

Timeline for d3tgf__: