Lineage for d2tgfa_ (2tgf A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031654Protein Transforming growth factor alpha [57217] (1 species)
  7. 3031655Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries)
  8. 3031660Domain d2tgfa_: 2tgf A: [44291]

Details for d2tgfa_

PDB Entry: 2tgf (more details)

PDB Description: the solution structure of human transforming growth factor alpha
PDB Compounds: (A:) transforming growth factor-alpha

SCOPe Domain Sequences for d2tgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tgfa_ g.3.11.1 (A:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOPe Domain Coordinates for d2tgfa_:

Click to download the PDB-style file with coordinates for d2tgfa_.
(The format of our PDB-style files is described here.)

Timeline for d2tgfa_: