SCOP 1.75: Domain d3egfa_: 3egf A:

Lineage for d3egfa_ (3egf A:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Epidermal growth factor, EGF [57215] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries)

8. Domain d3egfa_: 3egf A: [44285]

Details for d3egfa_

PDB Entry: 3egf

PDB Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints

PDB Compounds: (A:) epidermal growth factor

SCOP Domain Sequences for d3egfa_:

Sequence; same for both SEQRES and ATOM records:

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr

Timeline for d3egfa_:

• d3egfa_ first appeared (with stable ids) in SCOP 1.55, called d3egf__
  
• d3egfa_ appears in SCOP 1.73
  
• d3egfa_ appears in SCOPe 2.01
  
• d3egfa_ appears in the current release, SCOPe 2.08