Lineage for d3egf__ (3egf -)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (6 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Epidermal growth factor, EGF [57215] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [57216] (7 PDB entries) 
Domain d3egf__: 3egf - [44285]
Details for d3egf__
PDB Entry: 3egf (more details)
PDB Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
SCOP Domain Sequences for d3egf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3egf__ g.3.11.1 (-) Epidermal growth factor, EGF {Mouse (Mus musculus)}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr
SCOP Domain Coordinates for d3egf__:
Click to download the PDB-style file with coordinates for d3egf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3egf__:
- d3egf__ first appeared (with stable ids) in SCOP 1.55
- d3egf__ appears in SCOP 1.57
- d3egf__ appears in SCOP 1.61
- d3egf__ appears in the current release, SCOPe 2.08, called d3egfa_
View in 3D