Lineage for d1a3p__ (1a3p -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39993Protein Epidermal growth factor, EGF [57215] (1 species)
  7. 39994Species Mouse (Mus musculus) [TaxId:10090] [57216] (7 PDB entries)
  8. 39995Domain d1a3p__: 1a3p - [44284]

Details for d1a3p__

PDB Entry: 1a3p (more details)

PDB Description: role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor, nmr, 20 structures

SCOP Domain Sequences for d1a3p__:

Sequence, based on SEQRES records: (download)

>d1a3p__ g.3.11.1 (-) Epidermal growth factor, EGF {Mouse (Mus musculus)}
pgxpssydgyclnggvxmhiesldsytcncvigysgdrcqtrdlr

Sequence, based on observed residues (ATOM records): (download)

>d1a3p__ g.3.11.1 (-) Epidermal growth factor, EGF {Mouse (Mus musculus)}
pgpssydgyclnggvmhiesldsytcncvigysgdrcqtrdlr

SCOP Domain Coordinates for d1a3p__:

Click to download the PDB-style file with coordinates for d1a3p__.
(The format of our PDB-style files is described here.)

Timeline for d1a3p__: