SCOP 1.59: Domain d1ddxc2: 1ddx C:2033-2073

Lineage for d1ddxc2 (1ddx C:2033-2073)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d1ddxc2: 1ddx C:2033-2073 [44277]
   Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1

Details for d1ddxc2

PDB Entry: 1ddx, 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

SCOP Domain Sequences for d1ddxc2:

Sequence; same for both SEQRES and ATOM records:

>d1ddxc2 g.3.11.1 (C:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1ddxc2:

• d1ddxc2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddxc2 appears in SCOP 1.57
  
• d1ddxc2 appears in SCOP 1.61
  
• d1ddxc2 appears in the current release, SCOPe 2.08