SCOP 1.55: Domain d6coxb2: 6cox B:33-73

Lineage for d6coxb2 (6cox B:33-73)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d6coxb2: 6cox B:33-73 [44274]
   Other proteins in same PDB: d6coxa1, d6coxb1

Details for d6coxb2

PDB Entry: 6cox, 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558 in i222 space group

SCOP Domain Sequences for d6coxb2:

Sequence; same for both SEQRES and ATOM records:

>d6coxb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d6coxb2:

• d6coxb2 appears in SCOP 1.57
  
• d6coxb2 appears in the current release, SCOPe 2.08