SCOP 1.55: Domain d3pghb2: 3pgh B:33-73

Lineage for d3pghb2 (3pgh B:33-73)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d3pghb2: 3pgh B:33-73 [44270]
   Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1

Details for d3pghb2

PDB Entry: 3pgh, 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, flurbiprofen

SCOP Domain Sequences for d3pghb2:

Sequence; same for both SEQRES and ATOM records:

>d3pghb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d3pghb2:

• d3pghb2 appears in SCOP 1.57
  
• d3pghb2 appears in the current release, SCOPe 2.08