SCOP 1.59: Domain d4coxd2: 4cox D:33-73

Lineage for d4coxd2 (4cox D:33-73)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d4coxd2: 4cox D:33-73 [44268]
   Other proteins in same PDB: d4coxa1, d4coxb1, d4coxc1, d4coxd1

Details for d4coxd2

PDB Entry: 4cox, 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, indomethacin

SCOP Domain Sequences for d4coxd2:

Sequence; same for both SEQRES and ATOM records:

>d4coxd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d4coxd2:

• d4coxd2 first appeared (with stable ids) in SCOP 1.55
  
• d4coxd2 appears in SCOP 1.57
  
• d4coxd2 appears in SCOP 1.61
  
• d4coxd2 appears in the current release, SCOPe 2.08