SCOPe 2.08: Domain d1pgfa2: 1pgf A:33-73

Lineage for d1pgfa2 (1pgf A:33-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
   Uniprot P05979 32-584

8. Domain d1pgfa2: 1pgf A:33-73 [44257]
   Other proteins in same PDB: d1pgfa1, d1pgfb1
   complexed with hem, imm, nag

Details for d1pgfa2

PDB Entry: 1pgf, 4.5 Å

PDB Description: prostaglandin h2 synthase-1 complexed with 1-(4-iodobenzoyl)-5- methoxy-2-methylindole-3-acetic acid (iodoindomethacin), cis model

PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1pgfa2:

Sequence; same for both SEQRES and ATOM records:

>d1pgfa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1pgfa2:

• d1pgfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1pgfa2 appears in SCOPe 2.07