Lineage for d1autl2 (1aut L:97-146)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39965Protein Activated protein c (autoprothrombin IIa) [57208] (1 species)
  7. 39966Species Human (Homo sapiens) [TaxId:9606] [57209] (1 PDB entry)
  8. 39968Domain d1autl2: 1aut L:97-146 [44245]
    Other proteins in same PDB: d1autc_

Details for d1autl2

PDB Entry: 1aut (more details), 2.8 Å

PDB Description: Human activated protein C

SCOP Domain Sequences for d1autl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens)}
ncsldnggcthycleevgwrrcscapgyklgddllqchpavkfpcgrpwk

SCOP Domain Coordinates for d1autl2:

Click to download the PDB-style file with coordinates for d1autl2.
(The format of our PDB-style files is described here.)

Timeline for d1autl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1autl1
View in 3D
Domains from other chains:
(mouse over for more information)
d1autc_