![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Factor X, N-terminal module [57205] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries) |
![]() | Domain d1whea1: 1whe A:47-86 [44242] Other proteins in same PDB: d1whea2 complexed with doh |
PDB Entry: 1whe (more details)
SCOP Domain Sequences for d1whea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whea1 g.3.11.1 (A:47-86) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} gdqceghpclnqghckdgigdytctcaegfegkncefstr
Timeline for d1whea1: