Lineage for d1apo__ (1apo -)
- Root: SCOP 1.67
Class g: Small proteins [56992] (72 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (6 families) 
Family g.3.11.1: EGF-type module [57197] (21 proteins) 
Protein Factor X, N-terminal module [57205] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries) 
Domain d1apo__: 1apo - [44240]
complexed with oh
Details for d1apo__
PDB Entry: 1apo (more details)
PDB Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding
SCOP Domain Sequences for d1apo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apo__ g.3.11.1 (-) Factor X, N-terminal module {Cow (Bos taurus)}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr
SCOP Domain Coordinates for d1apo__:
Click to download the PDB-style file with coordinates for d1apo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1apo__:
- d1apo__ first appeared (with stable ids) in SCOP 1.55
- d1apo__ appears in SCOP 1.65
- d1apo__ appears in SCOP 1.69
- d1apo__ appears in the current release, SCOPe 2.08, called d1apoa_
View in 3D