![]() | Class g: Small proteins [56992] (72 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (21 proteins) |
![]() | Protein Factor X, N-terminal module [57205] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries) |
![]() | Domain d1apo__: 1apo - [44240] complexed with oh |
PDB Entry: 1apo (more details)
SCOP Domain Sequences for d1apo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apo__ g.3.11.1 (-) Factor X, N-terminal module {Cow (Bos taurus)} kdgdqceghpclnqghckdgigdytctcaegfegkncefstr
Timeline for d1apo__: