Lineage for d1apo__ (1apo -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143154Protein Factor X, N-terminal module [57205] (2 species)
  7. 143155Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 143157Domain d1apo__: 1apo - [44240]

Details for d1apo__

PDB Entry: 1apo (more details)

PDB Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding

SCOP Domain Sequences for d1apo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apo__ g.3.11.1 (-) Factor X, N-terminal module {Cow (Bos taurus)}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr

SCOP Domain Coordinates for d1apo__:

Click to download the PDB-style file with coordinates for d1apo__.
(The format of our PDB-style files is described here.)

Timeline for d1apo__: