Lineage for d1kigl_ (1kig L:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143154Protein Factor X, N-terminal module [57205] (2 species)
  7. 143155Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 143156Domain d1kigl_: 1kig L: [44239]
    Other proteins in same PDB: d1kigh_, d1kigi_

Details for d1kigl_

PDB Entry: 1kig (more details), 3 Å

PDB Description: bovine factor xa

SCOP Domain Sequences for d1kigl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus)}
csldnggcdqfcreersevrcscahgyvlgddskscvsterfpcgkftqgr

SCOP Domain Coordinates for d1kigl_:

Click to download the PDB-style file with coordinates for d1kigl_.
(The format of our PDB-style files is described here.)

Timeline for d1kigl_: