Lineage for d1esla2 (1esl A:119-157)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889668Protein E-selectin, EGF-domain [57203] (1 species)
  7. 889669Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 889671Domain d1esla2: 1esl A:119-157 [44225]
    Other proteins in same PDB: d1esla1
    complexed with ca, cl

Details for d1esla2

PDB Entry: 1esl (more details), 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains
PDB Compounds: (A:) human e-selectin

SCOP Domain Sequences for d1esla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esla2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
taactntscsghgecvetinnytckcdpgfsglkceqiv

SCOP Domain Coordinates for d1esla2:

Click to download the PDB-style file with coordinates for d1esla2.
(The format of our PDB-style files is described here.)

Timeline for d1esla2:

889671
d1esla2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1esla1