Lineage for d1f7ma_ (1f7m A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031278Domain d1f7ma_: 1f7m A: [44224]
    N-terminal domain

Details for d1f7ma_

PDB Entry: 1f7m (more details)

PDB Description: the first egf-like domain from human blood coagulation fvii, nmr, minimized average structure
PDB Compounds: (A:) PROTEIN (Blood Coagulation Factor VII)

SCOPe Domain Sequences for d1f7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ma_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
sdgdqcasspcqnggsckdqlqsyicfclpafegrncethkddgsa

SCOPe Domain Coordinates for d1f7ma_:

Click to download the PDB-style file with coordinates for d1f7ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f7ma_: