Lineage for d1dvam1 (1dva M:42-86)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747714Protein Coagulation factor VIIa [57201] (1 species)
  7. 747715Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
  8. 747734Domain d1dvam1: 1dva M:42-86 [44218]
    Other proteins in same PDB: d1dvah_, d1dvai_

Details for d1dvam1

PDB Entry: 1dva (more details), 3 Å

PDB Description: crystal structure of the complex between the peptide exosite inhibitor e-76 and coagulation factor viia
PDB Compounds: (M:) des-gla factor viia (light chain)

SCOP Domain Sequences for d1dvam1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvam1 g.3.11.1 (M:42-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
isysdgdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1dvam1:

Click to download the PDB-style file with coordinates for d1dvam1.
(The format of our PDB-style files is described here.)

Timeline for d1dvam1: