Lineage for d1qfkl2 (1qfk L:87-144)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (5 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Coagulation factor VIIa [57201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57202] (11 PDB entries) 
Domain d1qfkl2: 1qfk L:87-144 [44215]
Other proteins in same PDB: d1qfkh_
Details for d1qfkl2
PDB Entry: 1qfk (more details), 2.8 Å
PDB Description: structure of human factor viia and its implications for the triggering of blood coagulation
SCOP Domain Sequences for d1qfkl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfkl2 g.3.11.1 (L:87-144) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
SCOP Domain Coordinates for d1qfkl2:
Click to download the PDB-style file with coordinates for d1qfkl2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qfkl2:
View in 3D
