Lineage for d1fakl2 (1fak L:87-143)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (4 families) 
Family g.3.11.1: EGF-type module [57197] (16 proteins) 
Protein Coagulation factor VIIa [57201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries) 
Domain d1fakl2: 1fak L:87-143 [44213]
Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2
Details for d1fakl2
PDB Entry: 1fak (more details), 2.1 Å
PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
SCOP Domain Sequences for d1fakl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fakl2 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
SCOP Domain Coordinates for d1fakl2:
Click to download the PDB-style file with coordinates for d1fakl2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fakl2:
- d1fakl2 appears in SCOP 1.57
- d1fakl2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1fakh_, d1faki_, d1fakt1, d1fakt2 |
