Lineage for d1fakl1 (1fak L:49-86)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889632Protein Coagulation factor VIIa [57201] (1 species)
  7. 889633Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
    Uniprot P08709 108-202
    Uniprot P08709 107-202
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 889644Domain d1fakl1: 1fak L:49-86 [44212]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2

Details for d1fakl1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
PDB Compounds: (L:) protein (blood coagulation factor viia)

SCOP Domain Sequences for d1fakl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fakl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1fakl1:

Click to download the PDB-style file with coordinates for d1fakl1.
(The format of our PDB-style files is described here.)

Timeline for d1fakl1: