![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
![]() | Domain d1fakl1: 1fak L:49-86 [44212] Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2 |
PDB Entry: 1fak (more details), 2.1 Å
SCOP Domain Sequences for d1fakl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fakl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d1fakl1:
![]() Domains from other chains: (mouse over for more information) d1fakh_, d1faki_, d1fakt1, d1fakt2 |