Lineage for d1fakl1 (1fak L:49-86)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39969Protein Coagulation factor VIIa [57201] (1 species)
  7. 39970Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries)
  8. 39974Domain d1fakl1: 1fak L:49-86 [44212]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2

Details for d1fakl1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant

SCOP Domain Sequences for d1fakl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fakl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens)}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1fakl1:

Click to download the PDB-style file with coordinates for d1fakl1.
(The format of our PDB-style files is described here.)

Timeline for d1fakl1: