Lineage for d1cvwl_ (1cvw L:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88840Protein Coagulation factor VIIa [57201] (1 species)
  7. 88841Species Human (Homo sapiens) [TaxId:9606] [57202] (11 PDB entries)
  8. 88845Domain d1cvwl_: 1cvw L: [44211]
    Other proteins in same PDB: d1cvwh_

Details for d1cvwl_

PDB Entry: 1cvw (more details), 2.28 Å

PDB Description: crystal structure of active site-inhibited human coagulation factor viia (des-gla)

SCOP Domain Sequences for d1cvwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvwl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens)}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOP Domain Coordinates for d1cvwl_:

Click to download the PDB-style file with coordinates for d1cvwl_.
(The format of our PDB-style files is described here.)

Timeline for d1cvwl_:

88845
d1cvwl_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1cvwh_